PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_20462g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family MYB
Protein Properties Length: 470aa    MW: 51255.8 Da    PI: 4.7921
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_20462g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.72e-162269148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+ Ed +lv +vk+ G g+W+++ ++ g+ R++k+c++rw ++l
    MA_20462g0010 22 KGPWTAAEDAILVAYVKENGEGSWNSVQKHSGLSRCGKSCRLRWANHL 69
                     79******************************************9986 PP

2Myb_DNA-binding51.52.3e-1675118146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T++E+  ++d++++lG++ W++ a+ m+ gRt++++k++w++
    MA_20462g0010  75 KGAFTPDEERMIIDLHAKLGNK-WARMAALMP-GRTDNEIKNYWNT 118
                      799*******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8551769IPR017930Myb domain
SuperFamilySSF466891.95E-2920116IPR009057Homeodomain-like
SMARTSM007174.8E-142171IPR001005SANT/Myb domain
PfamPF002492.0E-142269IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.2E-222376IPR009057Homeodomain-like
CDDcd001673.10E-102469No hitNo description
PROSITE profilePS5129424.77170124IPR017930Myb domain
SMARTSM007171.6E-1574122IPR001005SANT/Myb domain
PfamPF002498.7E-1575118IPR001005SANT/Myb domain
CDDcd001671.80E-1177118No hitNo description
Gene3DG3DSA:1.10.10.601.5E-2577124IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
MKKGRGIEDG TSLFTGEGAL KKGPWTAAED AILVAYVKEN GEGSWNSVQK HSGLSRCGKS  60
CRLRWANHLR PNLKKGAFTP DEERMIIDLH AKLGNKWARM AALMPGRTDN EIKNYWNTRI  120
KRRMRAGLSL YPPEVGAQGQ GLDSIASVHS LHKPEEHGVF MGFGRGSCLT GLSEINLGNI  180
NSGGFTDVCI DQDDGGLSSM LKRTNESSIS IDMQGFLLES NPNTMVSLSN NSNSNTFYSV  240
FGVSGLKLEL PSSQSALSAG SADTPKSNLS FTNFSFSSSS FQQPNCLVSE ADSFNDNNSG  300
LLEALLLQET QSHNNNKYVD SAGHRVEKES EPNLQIIDLQ NNSKEHGESQ VQAVQADIQC  360
ADEEILSLLD FAKPDPLILP EWYSSSPLSS GIYNSKEGSV VPLGSAFDSQ ECEVVVVDLD  420
DSTCNNNNND NQYVWDLMGS CVWNSMPGAY QLSDLQANFE HSRNPMTGGR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-31201245108B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G32460.18e-69myb domain protein 101